Lineage for d4m3da2 (4m3d A:95-214)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2011555Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 2011556Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 2011557Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)
  6. 2011564Protein Ethr repressor [109978] (2 species)
  7. 2011565Species Mycobacterium tuberculosis [TaxId:1773] [109979] (34 PDB entries)
    Uniprot P96222 22-215
  8. 2011582Domain d4m3da2: 4m3d A:95-214 [257064]
    Other proteins in same PDB: d4m3da1
    automated match to d1t56a2
    protein/DNA complex; complexed with 2h2

Details for d4m3da2

PDB Entry: 4m3d (more details), 1.9 Å

PDB Description: Rapid and efficient design of new inhibitors of Mycobacterium tuberculosis transcriptional repressor EthR using fragment growing, merging and linking approaches
PDB Compounds: (A:) HTH-type transcriptional regulator EthR

SCOPe Domain Sequences for d4m3da2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4m3da2 a.121.1.1 (A:95-214) Ethr repressor {Mycobacterium tuberculosis [TaxId: 1773]}
adtdrenmwrtginvffetfgshkavtragqaaratsvevaelwstfmqkwiaytaavid
aerdrgaaprtlpahelatalnlmnertlfasfageqpsvpearvldtlvhiwvtsiyge

SCOPe Domain Coordinates for d4m3da2:

Click to download the PDB-style file with coordinates for d4m3da2.
(The format of our PDB-style files is described here.)

Timeline for d4m3da2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4m3da1