SCOPe 2.01: Domain d1efta1: 1eft A:213-312

Lineage for d1efta1 (1eft A:213-312)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.3: Translation proteins [50447] (6 families)

5. Family b.43.3.1: Elongation factors [50448] (10 proteins)

6. Protein Elongation factor Tu (EF-Tu), domain 2 [50449] (4 species)
   N-terminal domain is related to G proteins; C-terminal domain is (6,10) barrel of circularly permuted topology

7. Species Thermus aquaticus [TaxId:271] [50451] (4 PDB entries)

8. Domain d1efta1: 1eft A:213-312 [25688]
   Other proteins in same PDB: d1efta2, d1efta3
   complexed with gnp, mg

Details for d1efta1

PDB Entry: 1eft, 2.5 Å

PDB Description: the crystal structure of elongation factor ef-tu from thermus aquaticus in the gtp conformation

PDB Compounds: (A:) elongation factor tu

SCOPe Domain Sequences for d1efta1:

Sequence; same for both SEQRES and ATOM records:

>d1efta1 b.43.3.1 (A:213-312) Elongation factor Tu (EF-Tu), domain 2 {Thermus aquaticus [TaxId: 271]}
pvrdvdkpflmpvedvftitgrgtvatgriergkvkvgdeveivglapetrktvvtgvem
hrktlqegiagdnvglllrgvsreevergqvlakpgsitp

Timeline for d1efta1:

• d1efta1 first appeared (with stable ids) in SCOP 1.55, called d1eft_1
  
• d1efta1 appears in SCOP 1.75
  
• d1efta1 appears in SCOPe 2.02
  
• d1efta1 appears in the current release, SCOPe 2.08