Lineage for d1dg1h1 (1dg1 H:205-296)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1126671Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 1126691Superfamily b.43.3: Translation proteins [50447] (6 families) (S)
  5. 1126692Family b.43.3.1: Elongation factors [50448] (10 proteins)
  6. 1126772Protein Elongation factor Tu (EF-Tu), domain 2 [50449] (4 species)
    N-terminal domain is related to G proteins; C-terminal domain is (6,10) barrel of circularly permuted topology
  7. 1126779Species Escherichia coli [TaxId:562] [50450] (7 PDB entries)
    Uniprot P02990
  8. 1126783Domain d1dg1h1: 1dg1 H:205-296 [25685]
    Other proteins in same PDB: d1dg1g2, d1dg1g3, d1dg1h2, d1dg1h3
    complexed with gdp, mg

Details for d1dg1h1

PDB Entry: 1dg1 (more details), 2.5 Å

PDB Description: whole, unmodified, ef-tu(elongation factor tu).
PDB Compounds: (H:) elongation factor tu

SCOPe Domain Sequences for d1dg1h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dg1h1 b.43.3.1 (H:205-296) Elongation factor Tu (EF-Tu), domain 2 {Escherichia coli [TaxId: 562]}
aidkpfllpiedvfsisgrgtvvtgrvergiikvgeeveivgiketqkstctgvemfrkl
ldegragenvgvllrgikreeiergqvlakpg

SCOPe Domain Coordinates for d1dg1h1:

Click to download the PDB-style file with coordinates for d1dg1h1.
(The format of our PDB-style files is described here.)

Timeline for d1dg1h1: