Class a: All alpha proteins [46456] (285 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) contains a small beta-sheet (wing) |
Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
Protein automated matches [190154] (52 species) not a true protein |
Species Vibrio cholerae [TaxId:243277] [256837] (1 PDB entry) |
Domain d4k2ea_: 4k2e A: [256838] automated match to d4ggga_ |
PDB Entry: 4k2e (more details), 1.8 Å
SCOPe Domain Sequences for d4k2ea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4k2ea_ a.4.5.0 (A:) automated matches {Vibrio cholerae [TaxId: 243277]} lqemeknsakavvllkamanerrlqilcmlldnelsvgelssrlelsqsalsqhlawlrr dglvntrkeaqtvfytlsstevkamiellhrlycq
Timeline for d4k2ea_: