PDB entry 4k2e

View 4k2e on RCSB PDB site
Description: HlyU from Vibrio cholerae N16961
Class: transcription activator
Keywords: Winged helix, DNA-binding domain, Hemolysin gene transcription regulator, DNA, S-HYDROXYCYSTEINE, TRANSCRIPTION ACTIVATOR
Deposited on 2013-04-09, released 2014-04-30
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-04-30, with a file datestamp of 2014-04-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.192
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional activator HlyU
    Species: Vibrio cholerae [TaxId:243277]
    Gene: hlyU, VC_0678
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4k2ea_
  • Chain 'B':
    Compound: Transcriptional activator HlyU
    Species: Vibrio cholerae [TaxId:243277]
    Gene: hlyU, VC_0678
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Transcriptional activator HlyU
    Species: Vibrio cholerae [TaxId:243277]
    Gene: hlyU, VC_0678
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Transcriptional activator HlyU
    Species: Vibrio cholerae [TaxId:243277]
    Gene: hlyU, VC_0678
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4k2eA (A:)
    gshmmpylkgapmnlqemeknsakavvllkamanerrlqilcmlldnelsvgelssrlel
    sqsalsqhlawlrrdglvntrkeaqtvfytlsstevkamiellhrlycqanq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4k2eA (A:)
    lqemeknsakavvllkamanerrlqilcmlldnelsvgelssrlelsqsalsqhlawlrr
    dglvntrkeaqtvfytlsstevkamiellhrlycq
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.