Lineage for d4jukb_ (4juk B:)

  1. Root: SCOPe 2.06
  2. 2265466Class h: Coiled coil proteins [57942] (7 folds)
  3. 2266922Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2266923Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2266924Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2267375Protein automated matches [254646] (34 species)
    not a true protein
  7. 2267623Species Influenza a virus [TaxId:573943] [256802] (1 PDB entry)
  8. 2267624Domain d4jukb_: 4juk B: [256803]
    Other proteins in same PDB: d4juka_
    automated match to d4n5zb_
    complexed with nag, so4

Details for d4jukb_

PDB Entry: 4juk (more details), 2.75 Å

PDB Description: crystal structure of h5n1 influenza virus hemagglutinin, clade 2.3.2.1
PDB Compounds: (B:) hemagglutinin HA2

SCOPe Domain Sequences for d4jukb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jukb_ h.3.1.1 (B:) automated matches {Influenza a virus [TaxId: 573943]}
glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkr

SCOPe Domain Coordinates for d4jukb_:

Click to download the PDB-style file with coordinates for d4jukb_.
(The format of our PDB-style files is described here.)

Timeline for d4jukb_: