Lineage for d1ewya1 (1ewy A:1-141)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1126671Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 1126987Superfamily b.43.4: Riboflavin synthase domain-like [63380] (3 families) (S)
  5. 1127009Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (9 proteins)
    coupled with a NADP-binding domain of alpha/beta class
  6. 1127029Protein Ferredoxin reductase (flavodoxin reductase) N-terminal domain [50415] (8 species)
  7. 1127030Species Anabaena sp., pcc 7119 [TaxId:1167] [50420] (24 PDB entries)
  8. 1127053Domain d1ewya1: 1ewy A:1-141 [25651]
    Other proteins in same PDB: d1ewya2, d1ewyb2, d1ewyc_
    complexed with fad, fes

Details for d1ewya1

PDB Entry: 1ewy (more details), 2.38 Å

PDB Description: anabaena pcc7119 ferredoxin:ferredoxin-nadp+-reductase complex
PDB Compounds: (A:) ferredoxin-nadp reductase

SCOPe Domain Sequences for d1ewya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ewya1 b.43.4.2 (A:1-141) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Anabaena sp., pcc 7119 [TaxId: 1167]}
tqakakhadvpvnlyrpnapfigkvisneplvkeggigivqhikfdltggnlkyiegqsi
giippgvdkngkpeklrlysiastrhgddvddktislcvrqleykhpesgetvygvcsty
lthiepgsevkitgpvgkeml

SCOPe Domain Coordinates for d1ewya1:

Click to download the PDB-style file with coordinates for d1ewya1.
(The format of our PDB-style files is described here.)

Timeline for d1ewya1: