SCOP 1.59: Domain d1quf_1: 1quf 8-141

Lineage for d1quf_1 (1quf 8-141)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (3 superfamilies)

4. Superfamily b.43.4: Riboflavin synthase domain-like [63380] (3 families)

5. Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (7 proteins)

6. Protein Ferredoxin reductase (flavodoxin reductase) N-terminal domain [50415] (8 species)

7. Species Cyanobacterium (Anabaena sp.), pcc 7119 [TaxId:1167] [50420] (12 PDB entries)

8. Domain d1quf_1: 1quf 8-141 [25650]
   Other proteins in same PDB: d1quf_2

Details for d1quf_1

PDB Entry: 1quf, 2.25 Å

PDB Description: x-ray structure of a complex nadp+-ferredoxin:nadp+ reductase from the cyanobacterium anabaena pcc 7119 at 2.25 angstroms

SCOP Domain Sequences for d1quf_1:

Sequence; same for both SEQRES and ATOM records:

>d1quf_1 b.43.4.2 (8-141) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Cyanobacterium (Anabaena sp.), pcc 7119}
advpvnlyrpnapfigkvisneplvkeggigivqhikfdltggnlkyiegqsigiippgv
dkngkpeklrlysiastrhgddvddktislcvrqleykhpesgetvygvcstylthiepg
sevkitgpvgkeml

Timeline for d1quf_1:

• d1quf_1 first appeared (with stable ids) in SCOP 1.55
  
• d1quf_1 appears in SCOP 1.57
  
• d1quf_1 appears in SCOP 1.61
  
• d1quf_1 appears in the current release, SCOPe 2.08, called d1qufa1