SCOP 1.59: Domain d1quf_2: 1quf 142-303

Lineage for d1quf_2 (1quf 142-303)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)

4. Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (5 families)

5. Family c.25.1.1: Reductases [52344] (4 proteins)

6. Protein Ferredoxin reductase (flavodoxin reductase) [52345] (8 species)

7. Species Cyanobacterium (Anabaena sp.), pcc 7119 [TaxId:1167] [52350] (12 PDB entries)

8. Domain d1quf_2: 1quf 142-303 [31540]
   Other proteins in same PDB: d1quf_1

Details for d1quf_2

PDB Entry: 1quf, 2.25 Å

PDB Description: x-ray structure of a complex nadp+-ferredoxin:nadp+ reductase from the cyanobacterium anabaena pcc 7119 at 2.25 angstroms

SCOP Domain Sequences for d1quf_2:

Sequence; same for both SEQRES and ATOM records:

>d1quf_2 c.25.1.1 (142-303) Ferredoxin reductase (flavodoxin reductase) {Cyanobacterium (Anabaena sp.), pcc 7119}
lpddpeanvimlatgtgiapmrtylwrmfkdaeraanpeyqfkgfswlvfgvpttpnily
keeleeiqqkypdnfrltyaisreqknpqggrmyiqdrvaehadqlwqliknekthtyic
glrgmeegidaalsaaaakegvtwsdyqkdlkkagrwhvety

Timeline for d1quf_2:

• d1quf_2 first appeared (with stable ids) in SCOP 1.55
  
• d1quf_2 appears in SCOP 1.57
  
• d1quf_2 appears in SCOP 1.61
  
• d1quf_2 appears in the current release, SCOPe 2.08, called d1qufa2