Lineage for d1aigp1 (1aig P:36-258)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.41: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50345] (1 superfamily) Superfamily b.41.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50346] (1 family) 
Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (1 protein) Protein Photosynthetic reaction centre [50348] (3 species) Species Rhodobacter sphaeroides [TaxId:1063] [50350] (23 PDB entries) 
Domain d1aigp1: 1aig P:36-258 [25474]
Other proteins in same PDB: d1aigh2, d1aigl1, d1aigm1, d1aign1, d1aigo1, d1aigp2
Details for d1aigp1
PDB Entry: 1aig (more details), 2.6 Å
PDB Description: photosynthetic reaction center from rhodobacter sphaeroides in the d+qb-charge separated state
SCOP Domain Sequences for d1aigp1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aigp1 b.41.1.1 (P:36-258) Photosynthetic reaction centre {Rhodobacter sphaeroides}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkrksvvaamlae
SCOP Domain Coordinates for d1aigp1:
Click to download the PDB-style file with coordinates for d1aigp1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1aigp1:
View in 3D
