Lineage for d1huka_ (1huk A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2400325Superfamily b.40.5: Inorganic pyrophosphatase [50324] (2 families) (S)
  5. 2400326Family b.40.5.1: Inorganic pyrophosphatase [50325] (2 proteins)
    barrel, closed; n=5, S=8
  6. 2400327Protein Inorganic pyrophosphatase [50326] (9 species)
    eukaryotic enzyme has additional secondary structures at both N- and C-termini
  7. 2400328Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50327] (19 PDB entries)
  8. 2400361Domain d1huka_: 1huk A: [25405]
    complexed with mg; mutant

Details for d1huka_

PDB Entry: 1huk (more details), 2.2 Å

PDB Description: refined structure of yeast inorganic pyrophosphatase and its k61r mutant
PDB Compounds: (A:) inorganic pyrophosphatase

SCOPe Domain Sequences for d1huka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1huka_ b.40.5.1 (A:) Inorganic pyrophosphatase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tyttrqigakntleykvyiekdgkpvsafhdiplyadkennifnmvveiprwtnakleit
keetlnpiiqdtkkgklrfvrncfphhgyihnygafpqtwedpnvshpetkavgdndpid
vleigetiaytgqvkqvkalgimalldegetdwkviaidindplapklndiedvekyfpg
llratnewfriykipdgkpenqfafsgeaknkkyaldiikethdswkqliagkssdskgi
dltnvtlpdtptyskaasdaippaslkadapidksidkwff

SCOPe Domain Coordinates for d1huka_:

Click to download the PDB-style file with coordinates for d1huka_.
(The format of our PDB-style files is described here.)

Timeline for d1huka_: