Lineage for d1huka_ (1huk A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13574Fold b.40: OB-fold [50198] (7 superfamilies)
  4. 14283Superfamily b.40.5: Inorganic pyrophosphatase [50324] (1 family) (S)
  5. 14284Family b.40.5.1: Inorganic pyrophosphatase [50325] (1 protein)
  6. 14285Protein Inorganic pyrophosphatase [50326] (4 species)
  7. 14286Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50327] (8 PDB entries)
  8. 14297Domain d1huka_: 1huk A: [25405]

Details for d1huka_

PDB Entry: 1huk (more details), 2.2 Å

PDB Description: refined structure of yeast inorganic pyrophosphatase and its k61r mutant

SCOP Domain Sequences for d1huka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1huka_ b.40.5.1 (A:) Inorganic pyrophosphatase {Baker's yeast (Saccharomyces cerevisiae)}
tyttrqigakntleykvyiekdgkpvsafhdiplyadkennifnmvveiprwtnakleit
keetlnpiiqdtkkgklrfvrncfphhgyihnygafpqtwedpnvshpetkavgdndpid
vleigetiaytgqvkqvkalgimalldegetdwkviaidindplapklndiedvekyfpg
llratnewfriykipdgkpenqfafsgeaknkkyaldiikethdswkqliagkssdskgi
dltnvtlpdtptyskaasdaippaslkadapidksidkwff

SCOP Domain Coordinates for d1huka_:

Click to download the PDB-style file with coordinates for d1huka_.
(The format of our PDB-style files is described here.)

Timeline for d1huka_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1hukb_