Lineage for d2gvba_ (2gvb A:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 798661Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 799407Superfamily b.40.4: Nucleic acid-binding proteins [50249] (16 families) (S)
  5. 800209Family b.40.4.7: Phage ssDNA-binding proteins [50315] (3 proteins)
    barrel, open; n*=5, S*=8; the members' structures vary greater that those from cellular organisms
  6. 800217Protein Gene V protein [50316] (2 species)
  7. 800218Species Enterobacteria phage M13, including coliphage f1 [TaxId:10870] [50317] (19 PDB entries)
  8. 800238Domain d2gvba_: 2gvb A: [25387]

Details for d2gvba_

PDB Entry: 2gvb (more details)

PDB Description: refined solution structure of the tyr 41--> his mutant of the m13 gene v protein. a comparison with the crystal structure
PDB Compounds: (A:) gene v protein

SCOP Domain Sequences for d2gvba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gvba_ b.40.4.7 (A:) Gene V protein {Enterobacteria phage M13, including coliphage f1 [TaxId: 10870]}
mikveikpsqaqfttrsgvsrqgkpyslneqlcyvdlgnehpvlvkitldegqpayapgl
ytvhlssfkvgqfgslmidrlrlvpak

SCOP Domain Coordinates for d2gvba_:

Click to download the PDB-style file with coordinates for d2gvba_.
(The format of our PDB-style files is described here.)

Timeline for d2gvba_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2gvbb_