PDB entry 2gvb
View 2gvb on RCSB PDB site
Description: refined solution structure of the tyr 41--> his mutant of the m13 gene v protein. a comparison with the crystal structure
Class: DNA-binding (viral)
Keywords: DNA-binding (viral)
Deposited on
1995-07-27, released
1995-10-15
The last revision prior to the SCOP 1.75 freeze date was dated
2003-04-01, with a file datestamp of
2007-06-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.03
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: gene v protein
Species: Bacteriophage M13
Database cross-references and differences (RAF-indexed):
Domains in SCOP 1.75: d2gvba_ - Chain 'B':
Compound: gene v protein
Species: Bacteriophage M13
Database cross-references and differences (RAF-indexed):
Domains in SCOP 1.75: d2gvbb_
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>2gvbA (A:)
mikveikpsqaqfttrsgvsrqgkpyslneqlcyvdlgnehpvlvkitldegqpayapgl
ytvhlssfkvgqfgslmidrlrlvpak
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>2gvbB (B:)
mikveikpsqaqfttrsgvsrqgkpyslneqlcyvdlgnehpvlvkitldegqpayapgl
ytvhlssfkvgqfgslmidrlrlvpak