Lineage for d4mrqa3 (4mrq A:259-367)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1876643Fold c.84: Phosphoglucomutase, first 3 domains [53737] (1 superfamily)
    consists of three similar domains with 3 layers (a/b/a) each; duplication
    core: mixed beta-sheet of 4 strands, order 2134, strand 4 is antiparallel to the rest
  4. 1876644Superfamily c.84.1: Phosphoglucomutase, first 3 domains [53738] (2 families) (S)
  5. 1876736Family c.84.1.0: automated matches [254314] (1 protein)
    not a true family
  6. 1876737Protein automated matches [254721] (2 species)
    not a true protein
  7. 1876738Species Pseudomonas aeruginosa [TaxId:208964] [256304] (2 PDB entries)
  8. 1876744Domain d4mrqa3: 4mrq A:259-367 [253829]
    Other proteins in same PDB: d4mrqa4
    automated match to d1p5dx3
    complexed with edo, peg, pge, tla, zn

Details for d4mrqa3

PDB Entry: 4mrq (more details), 1.9 Å

PDB Description: Crystal Structure of wild-type unphosphorylated PMM/PGM
PDB Compounds: (A:) Phosphomannomutase/phosphoglucomutase

SCOPe Domain Sequences for d4mrqa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mrqa3 c.84.1.0 (A:259-367) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
ypdrllmlfakdvvsrnpgadiifdvkctrrlialisgyggrpvmwktghslikkkmket
gallagemsghvffkerwfgfddgiysaarlleilsqdqrdsehvfsaf

SCOPe Domain Coordinates for d4mrqa3:

Click to download the PDB-style file with coordinates for d4mrqa3.
(The format of our PDB-style files is described here.)

Timeline for d4mrqa3: