Class b: All beta proteins [48724] (174 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) |
Family b.40.4.7: Phage ssDNA-binding proteins [50315] (4 proteins) barrel, open; n*=5, S*=8; the members' structures vary greater that those from cellular organisms |
Protein Gene V protein [50316] (2 species) |
Species Enterobacteria phage M13, including coliphage f1 [TaxId:10870] [50317] (19 PDB entries) |
Domain d1gkha_: 1gkh A: [25371] mutant |
PDB Entry: 1gkh (more details), 1.7 Å
SCOPe Domain Sequences for d1gkha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gkha_ b.40.4.7 (A:) Gene V protein {Enterobacteria phage M13, including coliphage f1 [TaxId: 10870]} mikveikpsqaqfttrsgvsrqgkpyslneqlcyvdlgneypvlvkitldegqpayapgl ytvhlssfhvgqfgslmidrlrlvpa
Timeline for d1gkha_: