Lineage for d1gkha_ (1gkh A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1123681Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1124635Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 1125476Family b.40.4.7: Phage ssDNA-binding proteins [50315] (4 proteins)
    barrel, open; n*=5, S*=8; the members' structures vary greater that those from cellular organisms
  6. 1125482Protein Gene V protein [50316] (2 species)
  7. 1125483Species Enterobacteria phage M13, including coliphage f1 [TaxId:10870] [50317] (19 PDB entries)
  8. 1125486Domain d1gkha_: 1gkh A: [25371]
    mutant

Details for d1gkha_

PDB Entry: 1gkh (more details), 1.7 Å

PDB Description: mutant k69h of gene v protein (single-stranded dna binding protein)
PDB Compounds: (A:) gene v protein

SCOPe Domain Sequences for d1gkha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gkha_ b.40.4.7 (A:) Gene V protein {Enterobacteria phage M13, including coliphage f1 [TaxId: 10870]}
mikveikpsqaqfttrsgvsrqgkpyslneqlcyvdlgneypvlvkitldegqpayapgl
ytvhlssfhvgqfgslmidrlrlvpa

SCOPe Domain Coordinates for d1gkha_:

Click to download the PDB-style file with coordinates for d1gkha_.
(The format of our PDB-style files is described here.)

Timeline for d1gkha_: