Lineage for d4lzia3 (4lzi A:187-283)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935697Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2935698Superfamily d.17.1: Cystatin/monellin [54403] (7 families) (S)
    has a additional strand at the N-terminus
  5. 2935875Family d.17.1.0: automated matches [191407] (1 protein)
    not a true family
  6. 2935876Protein automated matches [190558] (13 species)
    not a true protein
  7. 2935931Species Potato (Solanum tuberosum) [TaxId:4113] [225839] (3 PDB entries)
  8. 2935934Domain d4lzia3: 4lzi A:187-283 [253706]
    automated match to d3imad_

Details for d4lzia3

PDB Entry: 4lzi (more details), 2.2 Å

PDB Description: Characterization of Solanum tuberosum Multicystatin and Significance of Core Domains
PDB Compounds: (A:) multicystatin

SCOPe Domain Sequences for d4lzia3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lzia3 d.17.1.0 (A:187-283) automated matches {Potato (Solanum tuberosum) [TaxId: 4113]}
gddsaiiggftdvpfpnnpefqdlarfavqdynkkenahleyvenlnvkeqlvagmiyyi
tlvatdagkkkiyeakiwvkewedfkkvvefklvgdd

SCOPe Domain Coordinates for d4lzia3:

Click to download the PDB-style file with coordinates for d4lzia3.
(The format of our PDB-style files is described here.)

Timeline for d4lzia3: