SCOP 1.61: Domain d1cko_1: 1cko 239-327

Lineage for d1cko_1 (1cko 239-327)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.40: OB-fold [50198] (8 superfamilies)

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (10 families)

5. Family b.40.4.6: DNA ligase/mRNA capping enzyme, domain 2 [50307] (3 proteins)

6. Protein RNA guanylyltransferase (mRNA capping enzyme) [50308] (1 species)

7. Species Chlorella virus, PBCV-1 [50309] (3 PDB entries)

8. Domain d1cko_1: 1cko 239-327 [25362]
   Other proteins in same PDB: d1cko_2

Details for d1cko_1

PDB Entry: 1cko, 3.1 Å

PDB Description: structure of mrna capping enzyme in complex with the cap analog gpppg

SCOP Domain Sequences for d1cko_1:

Sequence; same for both SEQRES and ATOM records:

>d1cko_1 b.40.4.6 (239-327) RNA guanylyltransferase (mRNA capping enzyme) {Chlorella virus, PBCV-1}
thhtidfiimsedgtigifdpnlrknvpvgkldgyynkgsivecgfadgtwkyiqgrsdk
nqandrltyektllnieenitidelldlf

Timeline for d1cko_1:

• d1cko_1 first appeared (with stable ids) in SCOP 1.55
  
• d1cko_1 appears in SCOP 1.59
  
• d1cko_1 appears in SCOP 1.63
  
• d1cko_1 appears in the current release, SCOPe 2.08, called d1ckoa1