Lineage for d1cko_2 (1cko 11-238)
- Root: SCOP 1.61
Class d: Alpha and beta proteins (a+b) [53931] (212 folds) 
Fold d.142: ATP-grasp [56058] (2 superfamilies) 
Superfamily d.142.2: DNA ligase/mRNA capping enzyme, catalytic domain [56091] (3 families) 
Family d.142.2.3: RNA guanylyltransferase (mRNA capping enzyme), N-terminal domain [56100] (1 protein) Protein RNA guanylyltransferase (mRNA capping enzyme), N-terminal domain [56101] (1 species) Species Chlorella virus, PBCV-1 [56102] (3 PDB entries) 
Domain d1cko_2: 1cko 11-238 [41589]
Other proteins in same PDB: d1cko_1
Details for d1cko_2
PDB Entry: 1cko (more details), 3.1 Å
PDB Description: structure of mrna capping enzyme in complex with the cap analog gpppg
SCOP Domain Sequences for d1cko_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cko_2 d.142.2.3 (11-238) RNA guanylyltransferase (mRNA capping enzyme), N-terminal domain {Chlorella virus, PBCV-1}
nitteravltlnglqiklhkvvgesrddivakmkdlamddhkfprlpgpnpvsierkdfe
klkqnkyvvsektdgirfmmfftrvfgfkvctiidramtvyllpfkniprvlfqgsifdg
elcvdivekkfafvlfdavvvsgvtvsqmdlasrffamkrslkefknvpedpailrykew
iplehptiikdhlkkanaiyhtdgliimsvdepviygrnfnlfklkpg
SCOP Domain Coordinates for d1cko_2:
Click to download the PDB-style file with coordinates for d1cko_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1cko_2:
- d1cko_2 first appeared (with stable ids) in SCOP 1.55
- d1cko_2 appears in SCOP 1.59
- d1cko_2 appears in SCOP 1.63
- d1cko_2 appears in the current release, SCOPe 2.08, called d1ckoa2
View in 3D
