Lineage for d4krob1 (4kro B:6-128)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2369702Species Llama (Lama glama) [TaxId:9844] [189241] (37 PDB entries)
  8. 2369740Domain d4krob1: 4kro B:6-128 [253409]
    Other proteins in same PDB: d4krob2
    automated match to d3lh2i_
    complexed with nag

Details for d4krob1

PDB Entry: 4kro (more details), 3.05 Å

PDB Description: nanobody/vhh domain ega1 in complex with the extracellular region of egfr
PDB Compounds: (B:) Nanobody/VHH domain EgA1

SCOPe Domain Sequences for d4krob1:

Sequence, based on SEQRES records: (download)

>d4krob1 b.1.1.0 (B:6-128) automated matches {Llama (Lama glama) [TaxId: 9844]}
esggglvqpggslrlscaasgrtfssyamgwfrqapgkqrefvaairwsggytyytdsvk
grftisrdnakttvylqmnslkpedtavyycaatylssdysryalpqrpldydywgqgtq
vtv

Sequence, based on observed residues (ATOM records): (download)

>d4krob1 b.1.1.0 (B:6-128) automated matches {Llama (Lama glama) [TaxId: 9844]}
eslscaasgrtfssyamgwfrqapgkqrefvaairwsggytyytdsvkgrftisrdnakt
tvylqmnslkpedtavyycaatylssdysryalpqrpldydywgqgtqvtv

SCOPe Domain Coordinates for d4krob1:

Click to download the PDB-style file with coordinates for d4krob1.
(The format of our PDB-style files is described here.)

Timeline for d4krob1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4krob2