Lineage for d4krob_ (4kro B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2031996Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2031997Protein automated matches [190740] (28 species)
    not a true protein
  7. 2034460Species Llama (Lama glama) [TaxId:9844] [189241] (9 PDB entries)
  8. 2034470Domain d4krob_: 4kro B: [253409]
    automated match to d3lh2i_
    complexed with nag

Details for d4krob_

PDB Entry: 4kro (more details), 3.05 Å

PDB Description: nanobody/vhh domain ega1 in complex with the extracellular region of egfr
PDB Compounds: (B:) Nanobody/VHH domain EgA1

SCOPe Domain Sequences for d4krob_:

Sequence, based on SEQRES records: (download)

>d4krob_ b.1.1.0 (B:) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvqlqesggglvqpggslrlscaasgrtfssyamgwfrqapgkqrefvaairwsggytyy
tdsvkgrftisrdnakttvylqmnslkpedtavyycaatylssdysryalpqrpldydyw
gqgtqvtv

Sequence, based on observed residues (ATOM records): (download)

>d4krob_ b.1.1.0 (B:) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvqlqeslscaasgrtfssyamgwfrqapgkqrefvaairwsggytyytdsvkgrftisr
dnakttvylqmnslkpedtavyycaatylssdysryalpqrpldydywgqgtqvtv

SCOPe Domain Coordinates for d4krob_:

Click to download the PDB-style file with coordinates for d4krob_.
(The format of our PDB-style files is described here.)

Timeline for d4krob_: