Lineage for d4kkbd1 (4kkb D:1-106)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1519111Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1519112Protein automated matches [190740] (19 species)
    not a true protein
  7. 1520466Species Mouse (Mus musculus) [TaxId:10090] [188198] (388 PDB entries)
  8. 1521135Domain d4kkbd1: 4kkb D:1-106 [253302]
    Other proteins in same PDB: d4kkba_, d4kkbb_, d4kkbd2, d4kkbf2
    automated match to d1ikfl1
    mutant

Details for d4kkbd1

PDB Entry: 4kkb (more details), 3.02 Å

PDB Description: Structure of the E148A mutant of CLC-ec1 deltaNC construct in 20mM fluoride and 20mM Bromide
PDB Compounds: (D:) Fab, light chain

SCOPe Domain Sequences for d4kkbd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kkbd1 b.1.1.0 (D:1-106) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divltqspaimsaapgdkvtmtcsasssvsyihwyqqksgtspkrwiydtskltsgvpvr
fsgsgsgtsysltintmeaedaatyycqqwsshpqtfgggtkleil

SCOPe Domain Coordinates for d4kkbd1:

Click to download the PDB-style file with coordinates for d4kkbd1.
(The format of our PDB-style files is described here.)

Timeline for d4kkbd1: