Class b: All beta proteins [48724] (177 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) |
Family b.40.4.4: Myf domain [50277] (7 proteins) |
Protein Domain B2 of PheRS-beta, PheT [50278] (1 species) |
Species Thermus thermophilus [TaxId:274] [50279] (12 PDB entries) identical sequence to Thermus aquaticus, TaxId: 271 |
Domain d1eiyb3: 1eiy B:39-151 [25314] Other proteins in same PDB: d1eiya1, d1eiya2, d1eiyb1, d1eiyb2, d1eiyb4, d1eiyb5, d1eiyb6 protein/RNA complex |
PDB Entry: 1eiy (more details), 3.3 Å
SCOPe Domain Sequences for d1eiyb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eiyb3 b.40.4.4 (B:39-151) Domain B2 of PheRS-beta, PheT {Thermus thermophilus [TaxId: 274]} fpiprgvvfarvleahpipgtrlkrlvldagrtvevvsgaenarkgigvalalpgtelpg lgqkvgerviqgvrsfgmalsprelgvgeygggllefpedalppgtplseawp
Timeline for d1eiyb3: