SCOPe 2.06: Domain d4j2lb_: 4j2l B:

Lineage for d4j2lb_ (4j2l B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.145: AXH domain [102030] (1 superfamily)
   pseudobarrel; some similarity to OB-fold

4. Superfamily b.145.1: AXH domain [102031] (2 families)
   automatically mapped to Pfam PF08517

5. Family b.145.1.1: AXH domain [102032] (2 proteins)

6. Protein automated matches [196747] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [196748] (4 PDB entries)

8. Domain d4j2lb_: 4j2l B: [252807]
   automated match to d1oa8d_

Details for d4j2lb_

PDB Entry: 4j2l, 3.15 Å

PDB Description: Crystal Structure of AXH domain complexed with Capicua

PDB Compounds: (B:) ataxin-1

SCOPe Domain Sequences for d4j2lb_:

Sequence; same for both SEQRES and ATOM records:

>d4j2lb_ b.145.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
apptlppyfmkgsiiqlangelkkvedlktedfiqsaeisndlkidsstveriedshspg
vaviqfavgehraqvsvevlveypffvfgqgwssccpertsqlfdlpcsklsvgdvcisl
tlk

Timeline for d4j2lb_:

• d4j2lb_ first appeared in SCOPe 2.04
  
• d4j2lb_ appears in SCOPe 2.05
  
• d4j2lb_ appears in SCOPe 2.07
  
• d4j2lb_ appears in the current release, SCOPe 2.08