Lineage for d4iuag3 (4iua G:212-290)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2638013Fold g.14: Kringle-like [57439] (1 superfamily)
    disulfide-rich fold; nearly all-beta
  4. 2638014Superfamily g.14.1: Kringle-like [57440] (3 families) (S)
  5. 2638015Family g.14.1.1: Kringle modules [57441] (7 proteins)
  6. 2638139Protein automated matches [226950] (2 species)
    not a true protein
  7. 2638160Species Mouse (Mus musculus) [TaxId:10090] [225317] (2 PDB entries)
  8. 2638176Domain d4iuag3: 4iua G:212-290 [252716]
    Other proteins in same PDB: d4iuaa1, d4iuab1, d4iuac1, d4iuad1, d4iuae1, d4iuaf1, d4iuag1, d4iuah1
    automated match to d1bhta2
    complexed with epe, so4

Details for d4iuag3

PDB Entry: 4iua (more details), 3.05 Å

PDB Description: crystal structure of the nk2 fragment (31-290) of the mouse hepatocyte growth factor/scatter factor
PDB Compounds: (G:) hepatocyte growth factor

SCOPe Domain Sequences for d4iuag3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4iuag3 g.14.1.1 (G:212-290) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
cmtangesyrgpmdhtesgktcqrwdqqtphrhkflperypdkgfddnycrnpdgkprpw
cytldpdtpweycaiktca

SCOPe Domain Coordinates for d4iuag3:

Click to download the PDB-style file with coordinates for d4iuag3.
(The format of our PDB-style files is described here.)

Timeline for d4iuag3: