Class g: Small proteins [56992] (98 folds) |
Fold g.10: Hairpin loop containing domain-like [57413] (1 superfamily) alpha+beta fold with two crossing loops |
Superfamily g.10.1: Hairpin loop containing domain-like [57414] (3 families) the middle part is structurally similar to some knottins and defensins but differs in the disulfide pattern |
Family g.10.1.1: Hairpin loop containing domain [57415] (2 proteins) automatically mapped to Pfam PF00024 |
Protein automated matches [191160] (2 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [189357] (3 PDB entries) |
Domain d4iuaf1: 4iua F:37-127 [252711] Other proteins in same PDB: d4iuaa2, d4iuaa3, d4iuab2, d4iuab3, d4iuac2, d4iuac3, d4iuad2, d4iuad3, d4iuae2, d4iuae3, d4iuaf2, d4iuaf3, d4iuag2, d4iuag3, d4iuah2, d4iuah3 automated match to d1bhta1 complexed with epe, so4 |
PDB Entry: 4iua (more details), 3.05 Å
SCOPe Domain Sequences for d4iuaf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4iuaf1 g.10.1.1 (F:37-127) automated matches {Mouse (Mus musculus) [TaxId: 10090]} rntlhefkksakttltkedpllkiktkkvnsadecanrcirnrgftftckafvfdksrkr cywypfnsmssgvkkgfghefdlyenkdyir
Timeline for d4iuaf1: