Lineage for d4iuad1 (4iua D:37-127)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1702965Fold g.10: Hairpin loop containing domain-like [57413] (1 superfamily)
    alpha+beta fold with two crossing loops
  4. 1702966Superfamily g.10.1: Hairpin loop containing domain-like [57414] (3 families) (S)
    the middle part is structurally similar to some knottins and defensins but differs in the disulfide pattern
  5. 1702967Family g.10.1.1: Hairpin loop containing domain [57415] (2 proteins)
    automatically mapped to Pfam PF00024
  6. 1702997Protein automated matches [191160] (2 species)
    not a true protein
  7. 1703003Species Mouse (Mus musculus) [TaxId:10090] [189357] (3 PDB entries)
  8. 1703010Domain d4iuad1: 4iua D:37-127 [252705]
    Other proteins in same PDB: d4iuaa2, d4iuaa3, d4iuab2, d4iuab3, d4iuac2, d4iuac3, d4iuad2, d4iuad3, d4iuae2, d4iuae3, d4iuaf2, d4iuaf3, d4iuag2, d4iuag3, d4iuah2, d4iuah3
    automated match to d1bhta1
    complexed with epe, so4

Details for d4iuad1

PDB Entry: 4iua (more details), 3.05 Å

PDB Description: crystal structure of the nk2 fragment (31-290) of the mouse hepatocyte growth factor/scatter factor
PDB Compounds: (D:) hepatocyte growth factor

SCOPe Domain Sequences for d4iuad1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4iuad1 g.10.1.1 (D:37-127) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rntlhefkksakttltkedpllkiktkkvnsadecanrcirnrgftftckafvfdksrkr
cywypfnsmssgvkkgfghefdlyenkdyir

SCOPe Domain Coordinates for d4iuad1:

Click to download the PDB-style file with coordinates for d4iuad1.
(The format of our PDB-style files is described here.)

Timeline for d4iuad1: