Class g: Small proteins [56992] (91 folds) |
Fold g.14: Kringle-like [57439] (1 superfamily) disulfide-rich fold; nearly all-beta |
Superfamily g.14.1: Kringle-like [57440] (3 families) |
Family g.14.1.1: Kringle modules [57441] (7 proteins) |
Protein automated matches [226950] (2 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [225317] (2 PDB entries) |
Domain d4iuac3: 4iua C:212-290 [252704] Other proteins in same PDB: d4iuaa1, d4iuab1, d4iuac1, d4iuad1, d4iuae1, d4iuaf1, d4iuag1, d4iuah1 automated match to d1bhta2 complexed with epe, so4 |
PDB Entry: 4iua (more details), 3.05 Å
SCOPe Domain Sequences for d4iuac3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4iuac3 g.14.1.1 (C:212-290) automated matches {Mouse (Mus musculus) [TaxId: 10090]} cmtangesyrgpmdhtesgktcqrwdqqtphrhkflperypdkgfddnycrnpdgkprpw cytldpdtpweycaiktca
Timeline for d4iuac3: