Lineage for d4il0c1 (4il0 C:6-136)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2554471Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2554472Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2554768Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2554769Protein automated matches [226922] (94 species)
    not a true protein
  7. 2555096Species Escherichia coli [TaxId:511145] [256302] (1 PDB entry)
  8. 2555099Domain d4il0c1: 4il0 C:6-136 [252628]
    Other proteins in same PDB: d4il0a2, d4il0b2, d4il0c2, d4il0d2, d4il0e2, d4il0f2, d4il0g2, d4il0h2
    automated match to d3n6ha1
    complexed with cit, gol

Details for d4il0c1

PDB Entry: 4il0 (more details), 2.8 Å

PDB Description: Crystal structure of GlucDRP from E. coli K-12 MG1655 (EFI target EFI-506058)
PDB Compounds: (C:) Glucarate dehydratase-related protein

SCOPe Domain Sequences for d4il0c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4il0c1 d.54.1.0 (C:6-136) automated matches {Escherichia coli [TaxId: 511145]}
spvitdmkvipvaghdsmllniggahnayftrnivvltdnaghtgigeapggdviyqtlv
daipmvlgqevarlnkvvqqvhkgnqaadfdtfgkgawtfelrvnavaaleaalldllgk
alnvpvcellg

SCOPe Domain Coordinates for d4il0c1:

Click to download the PDB-style file with coordinates for d4il0c1.
(The format of our PDB-style files is described here.)

Timeline for d4il0c1: