Lineage for d4i9xc2 (4i9x C:115-154)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2639372Fold g.24: TNF receptor-like [57585] (1 superfamily)
    duplication: consists of three similar disulfide-rich domains
  4. 2639373Superfamily g.24.1: TNF receptor-like [57586] (3 families) (S)
  5. 2639537Family g.24.1.0: automated matches [227277] (1 protein)
    not a true family
  6. 2639538Protein automated matches [227086] (2 species)
    not a true protein
  7. 2639542Species Human (Homo sapiens) [TaxId:9606] [226418] (4 PDB entries)
  8. 2639544Domain d4i9xc2: 4i9x C:115-154 [252596]
    automated match to d1d4va2
    complexed with ca, na, nag

Details for d4i9xc2

PDB Entry: 4i9x (more details), 2.1 Å

PDB Description: crystal structure of human cytomegalovirus glycoprotein ul141 targeting the death receptor trail-r2
PDB Compounds: (C:) Tumor necrosis factor receptor superfamily member 10B

SCOPe Domain Sequences for d4i9xc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i9xc2 g.24.1.0 (C:115-154) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rctrcdsgevelspctttrntvcqceegtfreedspemcr

SCOPe Domain Coordinates for d4i9xc2:

Click to download the PDB-style file with coordinates for d4i9xc2.
(The format of our PDB-style files is described here.)

Timeline for d4i9xc2: