Class g: Small proteins [56992] (98 folds) |
Fold g.24: TNF receptor-like [57585] (1 superfamily) duplication: consists of three similar disulfide-rich domains |
Superfamily g.24.1: TNF receptor-like [57586] (3 families) |
Family g.24.1.0: automated matches [227277] (1 protein) not a true family |
Protein automated matches [227086] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [226418] (4 PDB entries) |
Domain d4i9xc2: 4i9x C:115-154 [252596] automated match to d1d4va2 complexed with ca, na, nag |
PDB Entry: 4i9x (more details), 2.1 Å
SCOPe Domain Sequences for d4i9xc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4i9xc2 g.24.1.0 (C:115-154) automated matches {Human (Homo sapiens) [TaxId: 9606]} rctrcdsgevelspctttrntvcqceegtfreedspemcr
Timeline for d4i9xc2: