SCOPe 2.08: Domain d4i9xc1: 4i9x C:78-114

Lineage for d4i9xc1 (4i9x C:78-114)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.24: TNF receptor-like [57585] (1 superfamily)
   duplication: consists of three similar disulfide-rich domains

4. Superfamily g.24.1: TNF receptor-like [57586] (3 families)

5. Family g.24.1.0: automated matches [227277] (1 protein)
   not a true family

6. Protein automated matches [227086] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226418] (4 PDB entries)

8. Domain d4i9xc1: 4i9x C:78-114 [252595]
   automated match to d2h9gr1
   complexed with ca, na, nag

Details for d4i9xc1

PDB Entry: 4i9x, 2.1 Å

PDB Description: crystal structure of human cytomegalovirus glycoprotein ul141 targeting the death receptor trail-r2

PDB Compounds: (C:) Tumor necrosis factor receptor superfamily member 10B

SCOPe Domain Sequences for d4i9xc1:

Sequence; same for both SEQRES and ATOM records:

>d4i9xc1 g.24.1.0 (C:78-114) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eglcppghhisedgrdcisckygqdysthwndllfcl

Timeline for d4i9xc1:

• d4i9xc1 first appeared in SCOPe 2.04
  
• d4i9xc1 appears in SCOPe 2.07