Lineage for d4h83b2 (4h83 B:148-385)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2445369Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2445853Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 2445854Protein automated matches [226923] (78 species)
    not a true protein
  7. 2446169Species Marine actinobacterium [TaxId:312284] [255974] (3 PDB entries)
  8. 2446171Domain d4h83b2: 4h83 B:148-385 [252391]
    Other proteins in same PDB: d4h83a1, d4h83b1, d4h83c1, d4h83d1, d4h83e1, d4h83f1
    automated match to d3bjsa2
    complexed with bct, gol, na, po4

Details for d4h83b2

PDB Entry: 4h83 (more details), 2.09 Å

PDB Description: Crystal structure of Mandelate racemase/muconate lactonizing enzyme (EFI target:502127)
PDB Compounds: (B:) Mandelate racemase/muconate lactonizing enzyme

SCOPe Domain Sequences for d4h83b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h83b2 c.1.11.0 (B:148-385) automated matches {Marine actinobacterium [TaxId: 312284]}
yrnelpmiaiggyygeplgsiademhnyqelglagvkfkvgglsaaedaaritaareaag
ddfiicidanqgykpavavdlsrriadlnirwfeepvewhndkrsmrdvryqgsvpvcag
qtefsasgcrdlmetgaidvcnfdsswsggptawlrtaaiatsydvqmghheepqvsthl
lasqphgtiaecfhpdrdpfwwnmitnrpklnngtltlsdrpglgwdlnwdyidqyrv

SCOPe Domain Coordinates for d4h83b2:

Click to download the PDB-style file with coordinates for d4h83b2.
(The format of our PDB-style files is described here.)

Timeline for d4h83b2: