SCOPe 2.07: Domain d4h83a1: 4h83 A:20-147

Lineage for d4h83a1 (4h83 A:20-147)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (94 species)
   not a true protein

7. Species Marine actinobacterium [TaxId:312284] [255973] (3 PDB entries)

8. Domain d4h83a1: 4h83 A:20-147 [252388]
   Other proteins in same PDB: d4h83a2, d4h83b2, d4h83c2, d4h83d2, d4h83e2, d4h83f2
   automated match to d3bjsa1
   complexed with bct, gol, na, po4

Details for d4h83a1

PDB Entry: 4h83, 2.09 Å

PDB Description: Crystal structure of Mandelate racemase/muconate lactonizing enzyme (EFI target:502127)

PDB Compounds: (A:) Mandelate racemase/muconate lactonizing enzyme

SCOPe Domain Sequences for d4h83a1:

Sequence, based on SEQRES records:

>d4h83a1 d.54.1.0 (A:20-147) automated matches {Marine actinobacterium [TaxId: 312284]}
ltitrietipmvaplarefrgshyhmthrativtrvhtdagiigeaytgdehetmfdidr
iiheelaptligqdamaierlwdsgykvtfdilrdrrlglvalaavntaiwdavgkalkm
plwklwgg

Sequence, based on observed residues (ATOM records):

>d4h83a1 d.54.1.0 (A:20-147) automated matches {Marine actinobacterium [TaxId: 312284]}
ltitrietipmvaplmthrativtrvhtdagiigeaytgdehetmfdidriiheelaptl
igqdamaierlwdsgykvtfdilrdrrlglvalaavntaiwdavgkalkmplwklwgg

Timeline for d4h83a1:

• d4h83a1 first appeared in SCOPe 2.04
  
• d4h83a1 appears in SCOPe 2.06
  
• d4h83a1 appears in the current release, SCOPe 2.08