Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
Protein automated matches [226922] (94 species) not a true protein |
Species Marine actinobacterium [TaxId:312284] [255973] (3 PDB entries) |
Domain d4h83a1: 4h83 A:20-147 [252388] Other proteins in same PDB: d4h83a2, d4h83b2, d4h83c2, d4h83d2, d4h83e2, d4h83f2 automated match to d3bjsa1 complexed with bct, gol, na, po4 |
PDB Entry: 4h83 (more details), 2.09 Å
SCOPe Domain Sequences for d4h83a1:
Sequence, based on SEQRES records: (download)
>d4h83a1 d.54.1.0 (A:20-147) automated matches {Marine actinobacterium [TaxId: 312284]} ltitrietipmvaplarefrgshyhmthrativtrvhtdagiigeaytgdehetmfdidr iiheelaptligqdamaierlwdsgykvtfdilrdrrlglvalaavntaiwdavgkalkm plwklwgg
>d4h83a1 d.54.1.0 (A:20-147) automated matches {Marine actinobacterium [TaxId: 312284]} ltitrietipmvaplmthrativtrvhtdagiigeaytgdehetmfdidriiheelaptl igqdamaierlwdsgykvtfdilrdrrlglvalaavntaiwdavgkalkmplwklwgg
Timeline for d4h83a1: