Lineage for d4h1ia_ (4h1i A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1923787Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 1923788Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 1923789Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 1923827Protein Thymidylate synthase [55833] (7 species)
  7. 1923962Species Human (Homo sapiens) [TaxId:9606] [55840] (24 PDB entries)
  8. 1924011Domain d4h1ia_: 4h1i A: [252362]
    automated match to d4eb4a_
    complexed with so4

Details for d4h1ia_

PDB Entry: 4h1i (more details), 3.1 Å

PDB Description: Structure of human thymidylate synthase at low salt conditions
PDB Compounds: (A:) Thymidylate synthase

SCOPe Domain Sequences for d4h1ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h1ia_ d.117.1.1 (A:) Thymidylate synthase {Human (Homo sapiens) [TaxId: 9606]}
pphgelqylgqiqhilrcgvrkddrtgtgtlsvfgmqaryslrdefpllttkrvfwkgvl
eellwfikgstnakelsskgvkiwdangsrdfldslgfstreegdlgpvygfqwrhfgae
yrdmesdysgqgvdqlqrvidtiktnpddrriimcawnprdlplmalppchalcqfyvvn
selscqlyqrsgdmglgvpfniasyalltymiahitglkpgdfihtlgdahiylnhiepl
kiqlqreprpfpklrilrkvekiddfkaedfqiegynphpt

SCOPe Domain Coordinates for d4h1ia_:

Click to download the PDB-style file with coordinates for d4h1ia_.
(The format of our PDB-style files is described here.)

Timeline for d4h1ia_: