Lineage for d4fjza3 (4fjz A:527-725)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1745105Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1745106Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 1745301Family a.118.1.6: Phoshoinositide 3-kinase (PI3K) helical domain [48399] (1 protein)
    automatically mapped to Pfam PF00613
    this is a repeat family; one repeat unit is 1e8y A:598-635 found in domain
  6. 1745302Protein Phoshoinositide 3-kinase (PI3K) helical domain [48400] (2 species)
  7. 1745303Species Human (Homo sapiens) [TaxId:9606] [48402] (58 PDB entries)
  8. 1745343Domain d4fjza3: 4fjz A:527-725 [252017]
    Other proteins in same PDB: d4fjza1, d4fjza2, d4fjza4
    automated match to d1e7ua1
    complexed with 4fj, so4

Details for d4fjza3

PDB Entry: 4fjz (more details), 3 Å

PDB Description: Crystal structure of PI3K-gamma in complex with pyrrolo-pyridine inhibitor 63
PDB Compounds: (A:) Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform

SCOPe Domain Sequences for d4fjza3:

Sequence, based on SEQRES records: (download)

>d4fjza3 a.118.1.6 (A:527-725) Phoshoinositide 3-kinase (PI3K) helical domain {Human (Homo sapiens) [TaxId: 9606]}
ialpkhqptpdpegdrvraempnqlrkqleaiiatdplnpltaedkellwhfryeslkhp
kaypklfssvkwgqqeivaktyqllarrevwdqsaldvgltmqlldcnfsdenvraiavq
klesledddvlhyllqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseiaqs
rhyqqrfavileaylrgcg

Sequence, based on observed residues (ATOM records): (download)

>d4fjza3 a.118.1.6 (A:527-725) Phoshoinositide 3-kinase (PI3K) helical domain {Human (Homo sapiens) [TaxId: 9606]}
ialpkaempnqlrkqleaiiatdplnpltaedkellwhfryeslkhpkaypklfssvkwg
qqeivaktyqllarrevwdqsaldvgltmqlldcnfsdenvraiavqklesledddvlhy
llqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavilea
ylrgcg

SCOPe Domain Coordinates for d4fjza3:

Click to download the PDB-style file with coordinates for d4fjza3.
(The format of our PDB-style files is described here.)

Timeline for d4fjza3: