Lineage for d1enfa1 (1enf A:2-101)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.40: OB-fold [50198] (7 superfamilies) 
Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) 
Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (11 proteins) 
Protein Staphylococcal enterotoxin H, SEH [50230] (1 species) Species Staphylococcus aureus [TaxId:1280] [50231] (3 PDB entries) 
Domain d1enfa1: 1enf A:2-101 [25198]
Other proteins in same PDB: d1enfa2
Details for d1enfa1
PDB Entry: 1enf (more details), 1.69 Å
PDB Description: crystal structure of staphylococcal enterotoxin h determined to 1.69 a resolution
SCOP Domain Sequences for d1enfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1enfa1 b.40.2.2 (A:2-101) Staphylococcal enterotoxin H, SEH {Staphylococcus aureus}
dlhdkseltdlalanaygqynhpfikeniksdeisgekdlifrnqgdsgndlrvkfatad
laqkfknknvdiygasfyykcekiseniseclyggttlns
SCOP Domain Coordinates for d1enfa1:
Click to download the PDB-style file with coordinates for d1enfa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1enfa1:
- d1enfa1 appears in SCOP 1.57
- d1enfa1 appears in the current release, SCOPe 2.08
View in 3D
