PDB entry 1enf

View 1enf on RCSB PDB site
Description: crystal structure of staphylococcal enterotoxin h determined to 1.69 a resolution
Deposited on 2000-03-21, released 2000-04-19
The last revision prior to the SCOP 1.55 freeze date was dated 2001-01-10, with a file datestamp of 2001-01-10.
Experiment type: XRAY
Resolution: 1.69 Å
R-factor: 0.164
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1enfA (A:)
    dlhdkseltdlalanaygqynhpfikeniksdeisgekdlifrnqgdsgndlrvkfatad
    laqkfknknvdiygasfyykcekiseniseclyggttlnseklaqerviganvwvdgiqk
    etelirtnkknvtlqeldikirkilsdkykiyykdseiskgliefdmktprdysfdiydl
    kgendyeidkiyednktlksddishidvnlyt