Lineage for d4fhka3 (4fhk A:546-725)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1745105Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1745106Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 1745301Family a.118.1.6: Phoshoinositide 3-kinase (PI3K) helical domain [48399] (1 protein)
    automatically mapped to Pfam PF00613
    this is a repeat family; one repeat unit is 1e8y A:598-635 found in domain
  6. 1745302Protein Phoshoinositide 3-kinase (PI3K) helical domain [48400] (2 species)
  7. 1745303Species Human (Homo sapiens) [TaxId:9606] [48402] (58 PDB entries)
  8. 1745329Domain d4fhka3: 4fhk A:546-725 [251976]
    Other proteins in same PDB: d4fhka1, d4fhka2, d4fhka4
    automated match to d1e7ua1
    complexed with 0u0, so4

Details for d4fhka3

PDB Entry: 4fhk (more details), 3 Å

PDB Description: crystal structure of pi3k-gamma in complex with imidazopyridazine 19e
PDB Compounds: (A:) Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform

SCOPe Domain Sequences for d4fhka3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fhka3 a.118.1.6 (A:546-725) Phoshoinositide 3-kinase (PI3K) helical domain {Human (Homo sapiens) [TaxId: 9606]}
empnqlrkqleaiiatdplnpltaedkellwhfryeslkhpkaypklfssvkwgqqeiva
ktyqllarrevwdqsaldvgltmqlldcnfsdenvraiavqklesledddvlhyllqlvq
avkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavileaylrgcg

SCOPe Domain Coordinates for d4fhka3:

Click to download the PDB-style file with coordinates for d4fhka3.
(The format of our PDB-style files is described here.)

Timeline for d4fhka3: