Lineage for d4ez6d2 (4ez6 D:469-876)

  1. Root: SCOPe 2.04
  2. 1689992Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1692262Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 1692263Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 1692264Family e.8.1.1: DNA polymerase I [56673] (5 proteins)
  6. 1692551Protein automated matches [226972] (8 species)
    not a true protein
  7. 1692560Species Geobacillus kaustophilus [TaxId:1462] [233275] (8 PDB entries)
  8. 1692568Domain d4ez6d2: 4ez6 D:469-876 [251828]
    Other proteins in same PDB: d4ez6a1, d4ez6d1
    automated match to d3pv8d2
    protein/DNA complex; complexed with dg3, mpd, so4

Details for d4ez6d2

PDB Entry: 4ez6 (more details), 1.64 Å

PDB Description: Bacillus DNA Polymerase I Large Fragment Complex 1
PDB Compounds: (D:) DNA polymerase

SCOPe Domain Sequences for d4ez6d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ez6d2 e.8.1.1 (D:469-876) automated matches {Geobacillus kaustophilus [TaxId: 1462]}
eqdrllveleqplssilaemefagvkvdtkrleqmgkelaeqlgtveqriyelagqefni
nspkqlgvilfeklqlpvlkktktgystsadvleklapyheivenilhyrqlgklqstyi
egllkvvrpatkkvhtifnqaltqtgrlsstepnlqnipirleegrkirqafvpsesdwl
ifaadysqielrvlahiaeddnlmeafrrdldihtktamdifqvsedevtpnmrrqakav
nygivygisdyglaqnlnisrkeaaefieryfesfpgvkrymenivqeakqkgyvttllh
rrrylpditsrnfnvrsfaermamntpiqgsaadiikkamidlnarlkeerlqahlllqv
hdelileapkeemerlcrlvpevmeqavtlrvplkvdyhygstwydak

SCOPe Domain Coordinates for d4ez6d2:

Click to download the PDB-style file with coordinates for d4ez6d2.
(The format of our PDB-style files is described here.)

Timeline for d4ez6d2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ez6d1