Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (239 species) not a true protein |
Species Bacillus anthracis [TaxId:198094] [189998] (4 PDB entries) |
Domain d4egbg1: 4egb G:1-321 [251749] Other proteins in same PDB: d4egba2, d4egbb2, d4egbc2, d4egbd2, d4egbe2, d4egbf2, d4egbg2, d4egbh2 automated match to d2hunb_ complexed with nad, ni, so4, suc |
PDB Entry: 4egb (more details), 3 Å
SCOPe Domain Sequences for d4egbg1:
Sequence, based on SEQRES records: (download)
>d4egbg1 c.2.1.0 (G:1-321) automated matches {Bacillus anthracis [TaxId: 198094]} mnilvtggagfigsnfvhymlqsyetykiinfdaltysgnlnnvksiqdhpnyyfvkgei qngellehvikerdvqvivnfaaeshvdrsienpipfydtnvigtvtllelvkkyphikl vqvstdevygslgktgrfteetplapnspyssskasadmialayyktyqlpvivtrcsnn ygpyqypekliplmvtnalegkklplygdglnvrdwlhvtdhcsaidvvlhkgrvgevyn iggnnektnvevveqiitllgktkkdieyvtdrlghdrryainaekmknefdwepkytfe qglqetvqwyekneewwkplk
>d4egbg1 c.2.1.0 (G:1-321) automated matches {Bacillus anthracis [TaxId: 198094]} mnilvtggagfigsnfvhymlqsyetykiinfdaltysgnlnnvksiqdhpnyyfvkgei qngellehvikerdvqvivnfaaesipfydtnvigtvtllelvkkyphiklvqvstdevy gslgktgrfteetplapnspyssskasadmialayyktyqlpvivtrcsnnygpyqypek liplmvtnalegkklplygdglnvrdwlhvtdhcsaidvvlhkgrvgevyniggnnektn vevveqiitllgktkkdieyvtddrryainaekmknefdwepkytfeqglqetvqwyekn eewwkplk
Timeline for d4egbg1: