Lineage for d4e02a2 (4e02 A:186-374)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2212981Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2212982Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2213541Family d.122.1.4: alpha-ketoacid dehydrogenase kinase, C-terminal domain [69804] (3 proteins)
  6. 2213560Protein automated matches [230554] (2 species)
    not a true protein
  7. 2213576Species Norway rat (Rattus norvegicus) [TaxId:10116] [233755] (13 PDB entries)
  8. 2213579Domain d4e02a2: 4e02 A:186-374 [251643]
    Other proteins in same PDB: d4e02a1
    automated match to d3tz0a2
    complexed with anp, k, mg, wj1

Details for d4e02a2

PDB Entry: 4e02 (more details), 2.15 Å

PDB Description: Crystal structure of branched-chain alpha-ketoacid dehydrogenase kinase/(S)-2-chloro-3-phenylpropanoic acid complex with AMPPNP
PDB Compounds: (A:) [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase, mitochondrial

SCOPe Domain Sequences for d4e02a2:

Sequence, based on SEQRES records: (download)

>d4e02a2 d.122.1.4 (A:186-374) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dfvgiictrlspkkiiekwvdfarrlcehkygnaprvringhvaarfpfipmpldyilpe
llknamratmeshldtpynvpdvvitianndvdliirisdrgggiahkdldrvmdyhftt
aeastqdprisplfghldmhsggqsgpmhgfgfglptsrayaeylggslqlqslqgigtd
vylrlrhid

Sequence, based on observed residues (ATOM records): (download)

>d4e02a2 d.122.1.4 (A:186-374) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dfvgiictrlspkkiiekwvdfarrlcehkygnaprvringhvaarfpfipmpldyilpe
llknamratmeshldtpynvpdvvitianndvdliirisdrgggiahkdldrvmdyhftt
agfgfglptsrayaeylggslqlqslqgigtdvylrlrhid

SCOPe Domain Coordinates for d4e02a2:

Click to download the PDB-style file with coordinates for d4e02a2.
(The format of our PDB-style files is described here.)

Timeline for d4e02a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4e02a1