Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily) 8-stranded mixed beta-sheet; 2 layers: alpha/beta |
Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) |
Family d.122.1.4: alpha-ketoacid dehydrogenase kinase, C-terminal domain [69804] (3 proteins) |
Protein automated matches [230554] (2 species) not a true protein |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [233755] (13 PDB entries) |
Domain d4e02a2: 4e02 A:186-374 [251643] Other proteins in same PDB: d4e02a1 automated match to d3tz0a2 complexed with anp, k, mg, wj1 |
PDB Entry: 4e02 (more details), 2.15 Å
SCOPe Domain Sequences for d4e02a2:
Sequence, based on SEQRES records: (download)
>d4e02a2 d.122.1.4 (A:186-374) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} dfvgiictrlspkkiiekwvdfarrlcehkygnaprvringhvaarfpfipmpldyilpe llknamratmeshldtpynvpdvvitianndvdliirisdrgggiahkdldrvmdyhftt aeastqdprisplfghldmhsggqsgpmhgfgfglptsrayaeylggslqlqslqgigtd vylrlrhid
>d4e02a2 d.122.1.4 (A:186-374) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} dfvgiictrlspkkiiekwvdfarrlcehkygnaprvringhvaarfpfipmpldyilpe llknamratmeshldtpynvpdvvitianndvdliirisdrgggiahkdldrvmdyhftt agfgfglptsrayaeylggslqlqslqgigtdvylrlrhid
Timeline for d4e02a2: