Lineage for d1bcpl_ (1bcp L:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.40: OB-fold [50198] (7 superfamilies) 
Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) 
Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins) 
Protein Pertussis toxin S5 subunit [50217] (1 species) Species Bordetella pertussis [TaxId:520] [50218] (3 PDB entries) 
Domain d1bcpl_: 1bcp L: [25143]
Other proteins in same PDB: d1bcpa_, d1bcpb1, d1bcpb2, d1bcpc1, d1bcpc2, d1bcpd_, d1bcpe_, d1bcpg_, d1bcph1, d1bcph2, d1bcpi1, d1bcpi2, d1bcpj_, d1bcpk_
Details for d1bcpl_
PDB Entry: 1bcp (more details), 2.7 Å
PDB Description: binary complex of pertussis toxin and atp
SCOP Domain Sequences for d1bcpl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bcpl_ b.40.2.1 (L:) Pertussis toxin S5 subunit {Bordetella pertussis}
lpthlyknftvqelalklkgknqefcltafmsgrslvraclsdaghehdtwfdtmlgfai
sayalksrialtvedspypgtpgdllelqicplngyce
SCOP Domain Coordinates for d1bcpl_:
Click to download the PDB-style file with coordinates for d1bcpl_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bcpl_:
- d1bcpl_ appears in SCOP 1.57
- d1bcpl_ appears in the current release, SCOPe 2.08
View in 3D
