Lineage for d1bcpi1 (1bcp I:90-199)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13574Fold b.40: OB-fold [50198] (7 superfamilies)
  4. 13632Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 13633Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)
  6. 13784Protein Pertussis toxin S2/S3 subunits, C-terminal domain [50213] (1 species)
  7. 13785Species Bordetella pertussis [TaxId:520] [50214] (3 PDB entries)
  8. 13793Domain d1bcpi1: 1bcp I:90-199 [25123]
    Other proteins in same PDB: d1bcpa_, d1bcpb2, d1bcpc2, d1bcpd_, d1bcpe_, d1bcpf_, d1bcpg_, d1bcph2, d1bcpi2, d1bcpj_, d1bcpk_, d1bcpl_

Details for d1bcpi1

PDB Entry: 1bcp (more details), 2.7 Å

PDB Description: binary complex of pertussis toxin and atp

SCOP Domain Sequences for d1bcpi1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bcpi1 b.40.2.1 (I:90-199) Pertussis toxin S2/S3 subunits, C-terminal domain {Bordetella pertussis}
tiyktgqpaadhyyskvtatrllastnsrlcavfvrdgqsvigacaspyegryrdmydal
rrllymiymsglavrvhvskeeqyydyedatfqtyaltgislcnpaasic

SCOP Domain Coordinates for d1bcpi1:

Click to download the PDB-style file with coordinates for d1bcpi1.
(The format of our PDB-style files is described here.)

Timeline for d1bcpi1: