SCOPe 2.06: Domain d4bqtd_: 4bqt D:

Lineage for d4bqtd_ (4bqt D:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds

4. Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families)

5. Family b.96.1.0: automated matches [193505] (1 protein)
   not a true family

6. Protein automated matches [193506] (6 species)
   not a true protein

7. Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (48 PDB entries)

8. Domain d4bqtd_: 4bqt D: [251307]
   automated match to d2c9tc_
   complexed with c5e, cl, co

Details for d4bqtd_

PDB Entry: 4bqt, 2.88 Å

PDB Description: aplysia californica achbp in complex with cytisine

PDB Compounds: (D:) Soluble acetylcholine receptor

SCOPe Domain Sequences for d4bqtd_:

Sequence; same for both SEQRES and ATOM records:

>d4bqtd_ b.96.1.0 (D:) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
qanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkvdsstnevdlvyyeqqrwkl
nslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipaqr
lsfmcdptgvdseegvtcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsatqt
rqvqhysccpepyidvnlvvkfrerr

Timeline for d4bqtd_:

• d4bqtd_ first appeared in SCOPe 2.04
  
• d4bqtd_ appears in SCOPe 2.05
  
• d4bqtd_ appears in SCOPe 2.07
  
• d4bqtd_ appears in the current release, SCOPe 2.08