SCOPe 2.04: Domain d4anua1: 4anu A:143-321

Lineage for d4anua1 (4anu A:143-321)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (9 families)

5. Family d.15.1.0: automated matches [191343] (1 protein)
   not a true family

6. Protein automated matches [190233] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187090] (41 PDB entries)

8. Domain d4anua1: 4anu A:143-321 [251079]
   Other proteins in same PDB: d4anua2, d4anua3, d4anua4
   automated match to d1e7ua3
   complexed with em7, so4

Details for d4anua1

PDB Entry: 4anu, 2.81 Å

PDB Description: Complexes of PI3Kgamma with isoform selective inhibitors.

PDB Compounds: (A:) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma isoform

SCOPe Domain Sequences for d4anua1:

Sequence, based on SEQRES records:

>d4anua1 d.15.1.0 (A:143-321) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sseesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwv
tskplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmakkkslmdip
esqseqdfvlrvcgrdeylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrke

Sequence, based on observed residues (ATOM records):

>d4anua1 d.15.1.0 (A:143-321) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sseesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwv
tskplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmeqdfvlrvcg
rdeylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrke

Timeline for d4anua1:

• d4anua1 is new in SCOPe 2.04-stable
  
• d4anua1 appears in SCOPe 2.05
  
• d4anua1 appears in the current release, SCOPe 2.08