Lineage for d3zvva1 (3zvv A:144-321)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2177211Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2177212Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2178713Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2178714Protein automated matches [190233] (22 species)
    not a true protein
  7. 2178753Species Human (Homo sapiens) [TaxId:9606] [187090] (78 PDB entries)
  8. 2178786Domain d3zvva1: 3zvv A:144-321 [250875]
    Other proteins in same PDB: d3zvva2, d3zvva3, d3zvva4
    automated match to d1e7ua3
    complexed with xaz

Details for d3zvva1

PDB Entry: 3zvv (more details), 2.5 Å

PDB Description: fragment bound to pi3kinase gamma
PDB Compounds: (A:) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma isoform

SCOPe Domain Sequences for d3zvva1:

Sequence, based on SEQRES records: (download)

>d3zvva1 d.15.1.0 (A:144-321) automated matches {Human (Homo sapiens) [TaxId: 9606]}
seesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwvt
skplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmakkkslmdipe
sqseqdfvlrvcgrdeylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrke

Sequence, based on observed residues (ATOM records): (download)

>d3zvva1 d.15.1.0 (A:144-321) automated matches {Human (Homo sapiens) [TaxId: 9606]}
seesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwvt
skplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmakdfvlrvcgr
deylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrke

SCOPe Domain Coordinates for d3zvva1:

Click to download the PDB-style file with coordinates for d3zvva1.
(The format of our PDB-style files is described here.)

Timeline for d3zvva1: