Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures |
Family c.23.16.0: automated matches [191336] (1 protein) not a true family |
Protein automated matches [190197] (18 species) not a true protein |
Species Coxiella burnetii [TaxId:777] [256102] (1 PDB entry) |
Domain d3tqid1: 3tqi D:5-207 [249987] Other proteins in same PDB: d3tqia2, d3tqia3, d3tqib2, d3tqib3, d3tqic2, d3tqic3, d3tqid2, d3tqid3 automated match to d1gpma2 |
PDB Entry: 3tqi (more details), 2.84 Å
SCOPe Domain Sequences for d3tqid1:
Sequence, based on SEQRES records: (download)
>d3tqid1 c.23.16.0 (D:5-207) automated matches {Coxiella burnetii [TaxId: 777]} ihqhrilildfgsqyaqliarrvreigvycelmpcdideetirdfnphgiilsggpetvt lshtlrapafifeigcpvlgicygmqtmayqlggkvnrtakaefghaqlrvlnpaflfdg iedqvspqgeplldvwmshgdivselppgfeatactdnsplaamadfkrrffglqfhpev thtpqghrilahfvihicqcipn
>d3tqid1 c.23.16.0 (D:5-207) automated matches {Coxiella burnetii [TaxId: 777]} ihqhrilildfgsqyaqliarrvreigvycelmpcdideetirdfnphgiilsggpeapa fifeigcpvlgicygmqtmayqlggkvnefghaqlrvlnpaflfdgiedqvspqgeplld vwmshgdivselppgfeatactdnsplaamadfkrrffglqfhpevthtpqghrilahfv ihicqcipn
Timeline for d3tqid1: