SCOPe 2.06: Domain d3tiaa_: 3tia A:

Lineage for d3tiaa_ (3tia A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
   consists of six 4-stranded beta-sheet motifs; meander

4. Superfamily b.68.1: Sialidases [50939] (3 families)

5. Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 proteins)

6. Protein automated matches [193245] (14 species)
   not a true protein

7. Species Influenza a virus [TaxId:382827] [193246] (9 PDB entries)

8. Domain d3tiaa_: 3tia A: [249879]
   automated match to d1ivga_
   complexed with ca, lnv, nag

Details for d3tiaa_

PDB Entry: 3tia, 1.8 Å

PDB Description: crystal structure of 1957 pandemic h2n2 neuraminidase complexed with laninamivir

PDB Compounds: (A:) Neuraminidase

SCOPe Domain Sequences for d3tiaa_:

Sequence; same for both SEQRES and ATOM records:

>d3tiaa_ b.68.1.1 (A:) automated matches {Influenza a virus [TaxId: 382827]}
veyrnwskpqcqitgfapfskdnsirlsaggdiwvtrepyvscdpgkcyqfalgqgttld
nkhsndtvhdriphrtllmnelgvpfhlgtrqvciawsssschdgkawlhvcitgddkna
tasfiydgrlvdsigswsqnilrtqesecvcingtctvvmtdgsasgradtrilfieegk
ivhisplsgsaqhieecscyprypgvrcicrdnwkgsnrpvvdinmedysidssyvcsgl
vgdtprnddsssnsncrnpnnergtqgvkgwafdngndlwmgrtiskesrsgyetfkvig
gwstpnsksqvnrqvivdnnnwsgysgifsvegkscinrcfyvelirgrpqetrvwwtsn
sivvfcgtsgtygtgswpdganinfmpi

Timeline for d3tiaa_:

• d3tiaa_ first appeared in SCOPe 2.04
  
• d3tiaa_ appears in SCOPe 2.05
  
• d3tiaa_ appears in SCOPe 2.07
  
• d3tiaa_ appears in the current release, SCOPe 2.08