Lineage for d3tdeb1 (3tde B:5-104)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1926950Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
    duplication: consists of 3 similar intertwined domains
    structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta
  4. 1926951Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) (S)
  5. 1927050Family d.130.1.0: automated matches [254267] (1 protein)
    not a true family
  6. 1927051Protein automated matches [254617] (8 species)
    not a true protein
  7. 1927118Species Mycobacterium tuberculosis [TaxId:1773] [256098] (1 PDB entry)
  8. 1927122Domain d3tdeb1: 3tde B:5-104 [249867]
    automated match to d1mxaa1
    complexed with na

Details for d3tdeb1

PDB Entry: 3tde (more details), 1.85 Å

PDB Description: crystal structure of s-adenosylmethionine synthetase rv1392 from mycobacterium tuberculosis
PDB Compounds: (B:) S-adenosylmethionine synthase

SCOPe Domain Sequences for d3tdeb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tdeb1 d.130.1.0 (B:5-104) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
grlftsesvteghpdkicdaisdsvldallaadprsrvavetlvttgqvhvvgevttsak
eafaditntvrarileigydssdkgfdgatcgvnigigaq

SCOPe Domain Coordinates for d3tdeb1:

Click to download the PDB-style file with coordinates for d3tdeb1.
(The format of our PDB-style files is described here.)

Timeline for d3tdeb1: