Class b: All beta proteins [48724] (178 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.0: automated matches [191502] (1 protein) not a true family |
Protein automated matches [190824] (29 species) not a true protein |
Species Steccherinum ochraceum [TaxId:92696] [256093] (5 PDB entries) |
Domain d3t6wb1: 3t6w B:1-131 [249799] automated match to d1gyca1 complexed with cbs, cu, gol, oxy, so4 |
PDB Entry: 3t6w (more details), 2.15 Å
SCOPe Domain Sequences for d3t6wb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3t6wb1 b.6.1.0 (B:1-131) automated matches {Steccherinum ochraceum [TaxId: 92696]} vqigpvtdlhivnadivpdgfvrpavnaggtfpgpviagnvgdnfqivtfnqliecsmlv dtsihwhgefqkgtnwadgpafitqcpiivgnsfsynfnvpgmagtywyhshlttqycdg lrgpfvvydpn
Timeline for d3t6wb1: